MilliporeSigma
All Photos(5)

Documents

WH0006421M2

Sigma-Aldrich

Monoclonal Anti-SFPQ antibody produced in mouse

clone 6D7, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-POMP100, Anti-PSF, Anti-splicing factor proline/glutamine-rich (polypyrimidine tract binding protein associated)
MDL number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6D7, monoclonal

form

buffered aqueous solution

species reactivity

human, rat, mouse

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SFPQ(6421)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB1404362SAB4200501SAB2702214
biological source

mouse

biological source

mouse

biological source

mouse

biological source

mouse

species reactivity

human, rat, mouse

species reactivity

human

species reactivity

rat, human, mouse

species reactivity

-

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified from hybridoma cell culture

antibody form

affinity isolated antibody

Gene Information

human ... SFPQ(6421)

Gene Information

human ... SFPQ(6421)

Gene Information

human ... SFPQ(6421)
mouse ... Sfpq(71514)
rat ... Sfpq(252855)

Gene Information

-

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Splicing factor proline and glutamine rich (SFPQ), also known as polypyrimidine tract-binding protein-associated-splicing factor (PSF), is a multifunctional nuclear protein. The protein is characterized with an N-terminal glycine rich domain, a proline/glutamine-rich domain (P/Q), two RNA recognition motifs (RRMs) and a C-terminal region with two nuclear localization signals. The SFPQ gene is mapped to human chromosome 1p34.

Immunogen

SFPQ (NP_005057, 269 a.a. ~ 361 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EEKISDSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITEDEFKRLFAKYGEPGEVFINKGKGFGFIKLESRALAEIAKAELDDTPMRGRQ

Application

Monoclonal Anti-SFPQ antibody produced in mouse has been used in Western Blotting and immunofluorescence.

Biochem/physiol Actions

Splicing factor proline and glutamine rich (SFPQ), along with its binding partner non-POU domain-containing octamer-binding protein (NONO/p54nrb), plays a vital role in RNA processing, RNA splicing and transcriptional regulation. Additionally, these proteins also play a regulatory role in selective nuclear retention of defective mRNAs. SFPQ participates in transcription repression by recruiting transcription regulator proteins Sin3a and histone deacetylase (HDAC).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Arginine methylation and citrullination of splicing factor proline- and glutamine-rich (SFPQ/PSF) regulates its association with mRNA
Ambrosius P. Snijders
RNA (2015)
The t(1;9)(p34;q34) and t(8;12)(p11;q15) fuse pre-mRNA processing proteins SFPQ (PSF) and CPSF6 to ABL and FGFR1
Claire H
Genes Chromosomes Cancer (2008)
Cell-type specific role of the RNA-binding protein, NONO, in the DNA double-strand break response in the mouse testes
DNA Repair (2017)
Paclitaxel Reduces Axonal Bclw to Initiate IP3R1-Dependent Axon Degeneration
Sarah E.Pease-Raissi
Neuron (2017)
Michelle E Watts et al.
BMC biology, 21(1), 127-127 (2023-05-27)
Circular RNA (circRNA) molecules, generated through non-canonical back-splicing of exon-exon junctions, have recently been implicated in diverse biological functions including transcriptional regulation and modulation of protein interactions. CircRNAs are emerging as a key component of the complex neural transcriptome implicated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service