AV34285

Anti-CORO1A (AB1) antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Coronin, actin binding protein, 1A
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 51 kDa
• 종 반응성: guinea pig, human, dog, bovine, rat, horse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_009005
• UniProt 수납 번호: Q2YD73
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CORO1A(11151)

설명

일반 설명

CORO1A is a WD-repeat protein that has been implicated in Mycobacterium leprae infection. Studies have reported that CORO1A localizes on the membrane of phagosomes that contain M. leprae, where Toll-like receptor (TLR) 2 is also present. CORO1A suppresses TLR-mediated signaling in human macrophages.
Rabbit Anti-CORO1A recognizes bovine, rat, rabbit, mouse, human, and canine CORO1A.

면역원

Synthetic peptide directed towards the C terminal region of human CORO1A

애플리케이션

Rabbit Anti-CORO1A can be used for western blot applications at a concentration of 1.25 μg/ml.

생화학적/생리학적 작용

CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.

서열

Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable