콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA006426

Sigma-Aldrich

Anti-RAPGEF1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-C3G protein, Anti-CRK SH3-binding GNRP, Anti-Guanine nucleotide-releasing factor 2, Anti-Rap guanine nucleotide exchange factor 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43
결합:
unconjugated
application:
IHC
클론:
polyclonal
종 반응성:
human
citations:
5
기술:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

recombinant expression
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

SWLEEKEKEVVSALRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASK

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... RAPGEF1(2889)

일반 설명

RAPGEF1 (Rap guanine nucleotide exchange factor 1) is a guanine nucleotide exchange factor, and the gene is localized to human chromosome 9q34.3. This protein has a ubiquitous expression pattern, and resides as a complex with Crk (CT10 regulator of kinase) family of proteins in the cytoplasm.
Rap guanine nucleotide exchange factor 1 is a protein encoded by the RAPGEF1 gene in humans. It is referred to as C3G and GRF2. It is mapped to human chromosome 9q34.3. It releases GDP from the inactive Rap1 protein. It may facilitate activation by binding to GTP. This protein acts as an exchange factor for Ras family of small GTPases.

면역원

Rap guanine nucleotide exchange factor 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

RAPGEF1 (Rap guanine nucleotide exchange factor 1) is responsible for the exchange of GDP with GTP from Rap1 protein, thus, activating it. Rap1 (Ras-related protein 1) protein in turn is involved in processes such as, differentiation, proliferation and apoptosis. It is up-regulated in small cell lung cancers, where it leads to aberrations in CRK (CT10 regulator of kinase)-Rap1 signaling pathway, and thus, acts as an oncogene. This protein participates in multiple signaling cascades, such as the growth factor-mediated and GPCR (G-protein coupled receptor)-mediated. It participates in T-cell and B-cell activation and cell adhesion. Its interaction with Rap1 results in secretion of MMP (matrix metalloproteinase)-2 and MMP-9 in serous ovarian cancer. This protein is thus, involved in metastasis of epithelial ovarian cancer (EOC).

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70078

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

S Takai et al.
Human genetics, 94(5), 549-550 (1994-11-01)
C3G, a human guanine nucleotide releasing protein for Ras protein, was mapped to human chromosome 9q34.3 by fluorescence in situ hybridization with R-banded chromosomes. C3G was originally identified as one of the CRK-binding proteins, similar to c-abl (9q34.1). Our result
Johanna Samuelsson et al.
International journal of oncology, 38(6), 1575-1577 (2011-03-15)
RAPGEF1 (also known as C3G and GRF2) is a guanine nucleotide exchange factor that releases GDP from the inactive Rap1 protein, facilitating its subsequent activation by the binding of GTP. Rap1 plays regulatory roles in proliferation, differentiation and apoptosis. Amplification
Vegesna Radha et al.
BMC cell biology, 5, 31-31 (2004-08-24)
The guanine nucleotide exchange factor C3G (RapGEF1) along with its effector proteins participates in signaling pathways that regulate eukaryotic cell proliferation, adhesion, apoptosis and embryonic development. It activates Rap1, Rap2 and R-Ras members of the Ras family of GTPases. C3G
Kunal Dayma et al.
Biochimica et biophysica acta, 1813(3), 456-465 (2011-01-13)
Cytoskeletal remodeling is responsible for cell plasticity and facilitates differentiation, motility and adherence related functions. C3G (RAPGEF1), an exchange factor for Ras family of small GTPases, regulates cytoskeletal reorganization to induce filopodia in epithelial cells and neurite growth in neuroblastoma
Ya-Ling Che et al.
Cancer letters, 359(2), 241-249 (2015-01-27)
Complete resection is pivotal to improve survival to epithelial ovarian cancer (EOC). Crk SH3-domain-binding guanine nucleotide-releasing factor (C3G) is involved in multiple signaling pathways and it has opposite roles in different cancers. The present study aimed to identify C3G expression

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.