추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
64 kDa
종 반응성
human, mouse, rabbit, horse, rat, guinea pig, dog, bovine
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... METTL3(56339)
일반 설명
Methyltransferase like 3 (METTL3), an RNA methyltransferase, is a member of the class I methyltransferase (MTase) family and contains the MTase domain. The METTL3 gene is mapped to human chromosome 14q11.2.
면역원
Synthetic peptide directed towards the middle region of human METTL3
애플리케이션
Anti-METTL3 antibody produced in rabbit has been used in western blotting.
생화학적/생리학적 작용
Methyltransferase like 3 (METTL3) is part of methyltransferase systems that mediates the m6methyladenosine modifications. It exists as a heterodimeric complex with METTL14. An elevated expression of METTL3 is observed in clear cell renal cell carcinoma and rheumatoid arthritis (RA). Mutations in the METTL3 gene are implicated in autoimmune thyroid disease (AITD) and neuroblastoma. It may function as a tumor-suppresser in colorectal cancer.
서열
Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Jun Bian et al.
Journal of cellular and molecular medicine, 24(16), 9280-9286 (2020-07-03)
Neuroblastoma ranks as the most commonly seen and deadly solid tumour in infancy. The aberrant activity of m6 A-RNA methyltransferase METTL3 is involved in human cancers. Therefore, functional genetic variants in the METTL3 gene may contribute to neuroblastoma risk. In
Wenhui Zheng et al.
Frontiers in oncology, 9, 1403-1403 (2020-01-11)
Methyltransferase-like 3 (METTL3), a predominantly catalytic enzyme in the N6-methyladenosine (m6A) methyltransferase system, is dysregulated and plays a dual role (oncogene or tumor suppressor) in different human cancers. The expression and pro- or anticancer role of METTL3 in different cancers
Xiang Wang et al.
Nature, 534(7608), 575-578 (2016-06-10)
Chemical modifications of RNA have essential roles in a vast range of cellular processes. N(6)-methyladenosine (m(6)A) is an abundant internal modification in messenger RNA and long non-coding RNA that can be dynamically added and removed by RNA methyltransferases (MTases) and
Fang Yu et al.
Nucleic acids research, 49(10), 5779-5797 (2021-05-29)
Faithful genome integrity maintenance plays an essential role in cell survival. Here, we identify the RNA demethylase ALKBH5 as a key regulator that protects cells from DNA damage and apoptosis during reactive oxygen species (ROS)-induced stress. We find that ROS
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.