콘텐츠로 건너뛰기
Merck
모든 사진(3)

문서

SAB2108476

Sigma-Aldrich

Anti-MYC

affinity isolated antibody

동의어(들):

Anti- MRTL, Anti- bHLHe39, Anti-c-Myc

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

50 kDa

종 반응성

guinea pig, mouse, rabbit, human, rat

농도

0.5-1 mg/mL

기술

immunoblotting: suitable
immunohistochemistry: suitable

수납 번호(accession number)

NM_002467

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MYC(4609)

일반 설명

The cellular myelocytomatosis (c-myc) gene mapped to human chromosome 8q24, is the cellular homologue of the v-myc gene originally isolated from an avian myelocytomatosis virus. c-myc is a member of MYC gene family. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that regulates the G1-S cell cycle transition.

면역원

Synthetic peptide directed towards the N terminal region of human MYC

생화학적/생리학적 작용

The cellular myelocytomatosis (c-myc) oncogene plays a vital role in cellular proliferation, differentiation, apoptosis and acts as transcriptional regulator of gene expression. c-Myc expression is essential and sufficient to assist most of the cells to enter synthetic (S) phase of the cell cycle. The encoded protein plays a crucial role in vasculogenesis and angiogenesis during cancer development and progression. c-Myc interacts with its binding partner Max and activates the transcription of growth promoting genes such as cyclin D2, ornithine decarboxylase and E2F1 and it also represses the transcription of multiple genes, especially p21 and p27, by binding to the transcription initiator element (Inr) in a complex with Max and either Sp1 or Miz1. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

서열

Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

이미 열람한 고객

8q24 prostate, breast, and colon cancer risk loci show tissue-specific long-range interaction with MYC.
Ahmadiyeh, Nasim, et al.
Proceedings of the National Academy of Sciences of the USA, 107, 9742-9746 (2010)
Xiaoyong Chen et al.
Virologica Sinica, 36(5), 1027-1035 (2021-04-09)
Host interferon-stimulated gene 20 (ISG20) exerts antiviral effects on viruses by degrading viral RNA or by enhancing IFN signaling. Here, we examined the role of ISG20 during pseudorabies virus (PRV) proliferation. We found that ISG20 modulates PRV replication by enhancing
Apoptotic signaling by c-MYC.
Hoffman B and Liebermann DA.
Oncogene, 27, 6462-6472 (2008)
8q24 prostate, breast, and colon cancer risk loci show tissue-specific long-range interaction with MYC
Ahmadiyeh N, et al.
Proceedings of the National Academy of Sciences of the USA, 107, 9742-9746 (2010)
Troy A Baudino et al.
Genes & development, 16(19), 2530-2543 (2002-10-09)
c-Myc promotes cell growth and transformation by ill-defined mechanisms. c-myc(-/-) mice die by embryonic day 10.5 (E10.5) with defects in growth and in cardiac and neural development. Here we report that the lethality of c-myc(-/-) embryos is also associated with

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.