SAB2108476

Anti-MYC

affinity isolated antibody

• 동의어(들): Anti- MRTL, Anti- bHLHe39, Anti-c-Myc
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 50 kDa
• 종 반응성: guinea pig, mouse, rabbit, human, rat
• 농도: 0.5-1 mg/mL
• 기술: immunoblotting: suitable; immunohistochemistry: suitable
• 수납 번호(accession number): NM_002467
• UniProt 수납 번호: P01106
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MYC(4609)

설명

일반 설명

The cellular myelocytomatosis (c-myc) gene mapped to human chromosome 8q24, is the cellular homologue of the v-myc gene originally isolated from an avian myelocytomatosis virus. c-myc is a member of MYC gene family. c-Myc gene codes for basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that regulates the G1-S cell cycle transition.

면역원

Synthetic peptide directed towards the N terminal region of human MYC

생화학적/생리학적 작용

The cellular myelocytomatosis (c-myc) oncogene plays a vital role in cellular proliferation, differentiation, apoptosis and acts as transcriptional regulator of gene expression. c-Myc expression is essential and sufficient to assist most of the cells to enter synthetic (S) phase of the cell cycle. The encoded protein plays a crucial role in vasculogenesis and angiogenesis during cancer development and progression. c-Myc interacts with its binding partner Max and activates the transcription of growth promoting genes such as cyclin D2, ornithine decarboxylase and E2F1 and it also represses the transcription of multiple genes, especially p21 and p27, by binding to the transcription initiator element (Inr) in a complex with Max and either Sp1 or Miz1. Overexpression of MYC in DLBCL (diffuse large B-cell lymphoma) results in poor outcome and invasive treatment when medicated with rituximab plus cyclophosphamide, doxorubicin, vincristine and prednisone (R-CHOP).

서열

Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable