MilliporeSigma
All Photos(3)

Documents

AV32303

Sigma-Aldrich

Anti-FOXL1 antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-Forkhead box L1
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

36 kDa

species reactivity

bovine, horse, human, pig, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOXL1(2300)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
AV31691AV32296AV32564
biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody form

IgG fraction of antiserum

antibody form

IgG fraction of antiserum

antibody form

IgG fraction of antiserum

UniProt accession no.

Q12952

UniProt accession no.

Q12946

UniProt accession no.

Q12946

UniProt accession no.

Q9H334

clone

polyclonal

clone

polyclonal

clone

polyclonal

clone

polyclonal

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

The Forkhead Box L1 (FoxL1) is a transcription factor that modulates epithelial growth and gastrointestinal development. This transcription factor has been implicated in pancreatic and gastrointestinal carcinogenesis and can also function as prognostic biomarker for clear cell renal cell carcinoma. Studies in mce have also revealed that FoxL1 can function as a biological marker of the hepatic progenitor cells.
Rabbit Anti-FOXL1 antibody recognizes canine, human, and mouse FOXL1.

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXL1

Application

Rabbit Anti-FOXL1 antibody can be used for western blot (2.5μg/ml) and IHC (4-8μg/ml) assays.

Biochem/physiol Actions

FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.

Sequence

Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Feng-Qiang Yang et al.
International journal of clinical and experimental pathology, 7(1), 110-122 (2014-01-16)
The Forkhead Box L1 (Foxl1) transcription factor regulates epithelial proliferation and development of gastrointestinal tract, and has been implicated in gastrointestinal and pancreatic tumorigenesis. However, the role of Foxl1 in renal cancer development and progression remains to be elucidated. The
Sara D Sackett et al.
Hepatology (Baltimore, Md.), 49(3), 920-929 (2008-12-24)
The liver contains a population of small bipotential facultative progenitor cells that reconstitute liver function when mature hepatocytes or cholangiocytes are unable to proliferate. Mesenchymal markers, including members of the forkhead transcription factor gene family, have been detected in hepatic

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service