MilliporeSigma
All Photos(1)

Documents

MSST0007

Sigma-Aldrich

SILuProt CLU Clusterin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Sign Into View Organizational & Contract Pricing

Synonym(s):
Apolipoprotein J, Clusterin, Testosterone-repressed prostate message 2 (TRPM-2)
NACRES:
NA.12

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

tag

His tagged
V5 tagged

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98% Heavy amino acids incorporation efficiency by MS

mol wt

56811.45

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... CLU(1191)

Related Categories

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MSST0008MSST0021MSST0059
recombinant

expressed in HEK 293 cells

recombinant

expressed in HEK 293 cells

recombinant

expressed in HEK 293 cells

recombinant

expressed in E. coli

assay

≥98% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

assay

≥95% (SDS-PAGE)

form

lyophilized powder

form

lyophilized powder

form

liquid

form

lyophilized powder

potency

≥98% Heavy amino acids incorporation efficiency by MS

potency

-

potency

≥98% Heavy amino acids incorporation efficiency by MS

potency

≥97% (Heavy amino acids incorporation efficiency by MS)

mol wt

56811.45

mol wt

-

mol wt

-

mol wt

-

General description

SILu Prot Clusterin is a recombinant, stable isotope-labeled human Clusterin which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of Clusterin in mass-spectrometry. SIL Prot Clusterin is a heterodimer of 2 subunits (alpha and beta) consisting of 427 amino acids (including N-terminal polyhistidine and V5 tags), with a calculated molecular weight of 50 kDa.

Biochem/physiol Actions

Clusterin is a secreted glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including anti-apoptotic cell survival, cell cycle regulation, cell adhesion, tissue remodeling and lipid transportation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.

Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESDPSRGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

13 - Non Combustible Solids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service