MilliporeSigma
All Photos(3)

Documents

N17001

Sigma-Aldrich

Noggin human

recombinant, expressed in HEK 293 cells, suitable for cell culture

Sign Into View Organizational & Contract Pricing

Synonym(s):
Noggin human
MDL number:
NACRES:
NA.77

recombinant

expressed in HEK 293 cells

Quality Level

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≤10 ng/mL ED50

mol wt

23 kDa (The protein migrates as a 25 kDa band on SDS-PAGE due to glycosylation)

technique(s)

cell culture | mammalian: suitable

storage temp.

−20°C

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
ECM002ECM001I17001
Noggin human recombinant, expressed in HEK 293 cells, suitable for cell culture

Sigma-Aldrich

N17001

Noggin human

Fibronectin human recombinant, expressed in HEK 293 cells, lyophilized powder, suitable for cell culture

Sigma-Aldrich

ECM001

Fibronectin human

Interferon-γ human IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested

Sigma-Aldrich

I17001

Interferon-γ human

assay

≥98% (SDS-PAGE)

assay

≥95% (SDS-PAGE)

assay

≥95% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

form

lyophilized powder

form

lyophilized powder

form

lyophilized powder

form

lyophilized powder

potency

≤10 ng/mL ED50

potency

-

potency

-

potency

≤0.250 ng/mL In Viral Resistance Assay ED50

mol wt

23 kDa (The protein migrates as a 25 kDa band on SDS-PAGE due to glycosylation)

mol wt

127.5 kDa (The protein migrates as a 140 kDa band on SDS-PAGE due to glycosylation.)

mol wt

259.5 kDa (The protein migrates as a higher band on SDS-PAGE due to glycosylation.)

mol wt

16 kDa (glycosylated)

technique(s)

cell culture | mammalian: suitable

technique(s)

cell culture | mammalian: suitable

technique(s)

cell culture | mammalian: suitable

technique(s)

cell culture | mammalian: suitable

General description

Recombinant human Noggin is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 23 kDa. This protein is manufactured in human cells using an all-human production system, with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture.

Biochem/physiol Actions

Noggin is a secreted protein that inhibits the binding of bone morphogenetic proteins (BMPs) to their cognate receptor. It is a 232 amino acid-secreted glycosylated protein, which forms covalently linked homodimers and has high affinity for BMP4. hESC cultured with noggin (in medium or incorporated into extracellular matrix) form denser colonies compared to normal hESC cultures, suggesting that the presence of noggin promotes better growth. Noggin can be incorporated as a medium supplement for maintaining stem cells in a pluripotent state, for short-term culture experiments. Noggin does not trigger differentiation towards a neuronal lineage. Furthermore, when incorporated into extracellular matrix, noggin prevented spontaneous differentiation during the time period examined. In a surgically induced knee osteoarthritis model in mice, expression of noggin mRNA was lost from the articular cartilage, which correlated with loss of BMP2/4 and pSMAD1/5/8, an indicator of active BMP signaling.

Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Analysis Note

The biological activity of recombinant human noggin was tested in culture by measuring its ability to inhibit BMP4-induced alkaline phosphatase production by ATDC5 cells (human erythroleukemic indicator cell line).
The EC50 is defined as the effective concentration of growth factor that elicits a 50% decrease in alkaline phosphatase secretion in a cell based bioassay.

Hazard Statements

Precautionary Statements

Hazard Classifications

Aquatic Chronic 3

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Customers Also Viewed

Slide 1 of 7

1 of 7

Bay 11-7082 ≥98% (HPLC), powder

Sigma-Aldrich

B5556

Bay 11-7082

Nicotinamide BioReagent, suitable for cell culture, suitable for insect cell culture

Sigma-Aldrich

N0636

Nicotinamide

SB 431542 hydrate ≥98% (HPLC), powder

Sigma-Aldrich

S4317

SB 431542 hydrate

SB 202190 ≥98% (HPLC)

Sigma-Aldrich

S7067

SB 202190

N-Acetyl-L-cysteine suitable for cell culture, BioReagent

Sigma-Aldrich

A9165

N-Acetyl-L-cysteine

The expression patterns of gremlin 1 and noggin in normal adult and tumor tissues.
Laurilla R, et al.
International Journal of Clinical and Experimental Pathology, 6(7), 1400-1408 (2013)
Wenjing Xiao et al.
Autophagy, 18(11), 2615-2635 (2022-03-08)
Macroautophagy/autophagy is a conserved cellular process associated with tumorigenesis and aggressiveness, while mechanisms regulating expression of autophagic machinery genes in cancers still remain elusive. Herein, we identified E2F4 (E2F transcription factor 4) as a novel transcriptional activator of cytoprotective autophagy

Articles

Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service