MilliporeSigma
All Photos(2)

Documents

WH0004586M7

Sigma-Aldrich

Monoclonal Anti-MUC5AC antibody produced in mouse

clone 2H7, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-MUC5, Anti-mucin 5, subtypes A and C, tracheobronchial/gastric
MDL number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2H7, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MUC5AC(4586)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB1404094AMAB91539SAB1403512
Gene Information

human ... MUC5AC(4586)

Gene Information

human ... MUC5AC(4586)

Gene Information

human ... MUC5AC(4586)

Gene Information

human ... MUC5B(727897)

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

antibody form

ascites fluid

species reactivity

human

species reactivity

human

species reactivity

human

species reactivity

human

clone

2H7, monoclonal

clone

2A4, monoclonal

clone

CL8961, monoclonal

clone

8C11, monoclonal

biological source

mouse

biological source

mouse

biological source

mouse

biological source

mouse

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Mucin 5AC (MUC5AC) is encoded by the gene mapped to human chromosome 11p15.5 and is predominantly expressed in the gastric and tracheobronchial mucosae. The MUC5AC protein contains two types of deduced peptide domains such as eight amino acid tandemly repeated (TR) domains and cysteine-rich domains.

Immunogen

MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Biochem/physiol Actions

Increased expression of Mucin 5AC (MUC5AC) leads to epithelial cancer progression, including colon cancer. Therefore, MUC5AC is considered to be a potential target in the treatment of colon cancer. MUC5AC containing the carbohydrate blood-group antigen, Lewis B (LeB) functions as a key receptor for Helicobacter pylori. O-glycoprotein encoded by the gene plays a vital role in mucus formation and epithelium protection. Decreased level of MUC5AC expression in ocular surface might lead to the tear instability in patients with SjÖgren syndrome.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Pablo Argüeso et al.
Investigative ophthalmology & visual science, 43(4), 1004-1011 (2002-03-30)
To determine whether the relative amounts of mucin mRNA in the conjunctival epithelium and mucin protein in the tears are altered in patients with Sjögren syndrome compared with healthy individuals. Tear fluid was collected from the inferior fornix of normal
A E Biemer-Hüttmann et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 47(8), 1039-1048 (1999-07-29)
We studied the distribution of the four human apomucins MUC1, MUC2, MUC4, and MUC5AC in hyperplastic polyps, serrated adenomas, and traditional adenomas of the colorectum using immunohistochemical techniques, with the aim of comparing and contrasting their patterns of expression. A
Michaël Perrais et al.
The Journal of biological chemistry, 277(35), 32258-32267 (2002-06-22)
The 11p15 mucin genes (MUC2, MUC5AC, MUC5B and MUC6) possess a cell-specific pattern of expression in normal lung that is altered during carcinogenesis. Growth factors of the epidermal growth factor family are known to target key genes that in turn
Xijia Zhu et al.
Cancer biotherapy & radiopharmaceuticals, 31(7), 261-267 (2016-09-10)
Deregulated expressions of mucins have been found in various malignancies and play a pivotal role in carcinogenesis. MUC5AC, as a secreted mucin, is reported to be aberrantly expressed during epithelial cancer progression, including colon cancer. However, the mechanisms of the
Jeroen H B Van de Bovenkamp et al.
Helicobacter, 8(5), 521-532 (2003-10-11)
Helicobacter pylori shows a characteristic tropism for the mucus-producing gastric epithelium. In infected patients, H. pylori colocalizes in situ with the gastric secretory mucin MUC5AC. The carbohydrate blood-group antigen Lewis B (LeB) was deemed responsible for the adherence of H.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service