추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
107 kDa
종 반응성
mouse, human, rabbit, dog, pig, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GRIK4(2900)
면역원
Synthetic peptide directed towards the N terminal region of human GRIK4
애플리케이션
Anti-GRIK4 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
생화학적/생리학적 작용
GRIK4 or glutamate receptor 4 receptor subunit modulates the synaptic transmission and cellular excitability in the brain. Mutations in GRIK4 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.
서열
Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 35(3), 727-740 (2009-11-20)
Single-nucleotide polymorphisms (SNPs) in the FKBP5, GRIK4, and HTR2A genes have been shown to be associated with response to citalopram treatment in the STAR(*)D sample, but only associations with FKBP5 have so far been tested in the Munich Antidepressant Response
Behavioural brain research, 228(2), 406-414 (2011-12-29)
There is a clear link between dysregulation of glutamatergic signaling and mood disorders. Genetic variants in the glutamate receptor gene GRIK4, which encodes the kainate receptor subunit GluK4, alter the susceptibility for depression, bipolar disorder and schizophrenia. Here we demonstrate
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.