SAB1402736

Monoclonal Anti-CRABP2 antibody produced in mouse

clone 4F2, purified immunoglobulin, buffered aqueous solution

• 동의어(들): CRABP-II, RBP6
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4F2, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~42.7 kDa
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_001878
• UniProt 수납 번호: P29373
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CRABP2(1382)

설명

일반 설명

A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein. (provided by RefSeq)

면역원

CRABP2 (NP_001869.1, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

애플리케이션

Monoclonal Anti-CRABP2 antibody produced in mouse is suitable for indirect ELISA and western blot applications.

생화학적/생리학적 작용

Cellular retinoic acid binding protein 2 (CRABP2) plays a crucial role in acceleration of the transcriptional activity. In the nucleus, by binding directly to the nuclear receptor RAR, it forms a complex for connecting retinoic acid (RA) from the binding protein to the receptor. This interaction finally helps to accelerate the transcriptional activity. It may have impact in the immature phenotype in glioma cells.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable