MilliporeSigma
All Photos(1)

Documents

MSST0064

Sigma-Aldrich

SILuProt Insulin, human

recombinant, expressed in Pichia pastoris, SIL MS Protein Standard, 15N -labeled

Sign Into View Organizational & Contract Pricing

Synonym(s):
in situ Proximity Ligation Assay reagent, Insulin
NACRES:
NA.32

recombinant

expressed in Pichia pastoris

Quality Level

assay

≥95% (HPLC)

form

dry pellets

potency

≥97% (Heavy amino acids incorporation efficiency by MS)

suitability

suitable for mass spectrometry (standard)

shipped in

ambient

storage temp.

−20°C

Gene Information

human ... INS(3630)

Related Categories

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MSST0063MSST0017MSST0007
Sigma-Aldrich

MSST0064

SILuProt Insulin, human

SILu™Prot CLU Clusterin human recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

MSST0007

SILuProt CLU Clusterin human

assay

≥95% (HPLC)

assay

≥95% (SDS-PAGE)

assay

98% (SDS-PAGE)

assay

≥98% (SDS-PAGE)

form

dry pellets

form

lyophilized

form

lyophilized powder

form

lyophilized powder

suitability

suitable for mass spectrometry (standard)

suitability

suitable for mass spectrometry (standard)

suitability

suitable for mass spectrometry (standard)

suitability

suitable for mass spectrometry

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

shipped in

ambient

shipped in

ambient

shipped in

-

shipped in

-

General description

SILu Prot Insulin is a recombinant, stable 15N isotope-labeled human Insulin Expressed in P. pastoris, it is designed to be used as an internal standard for bioanalysis of Insulin in mass-spectrometry. SILu Prot Insulin is a disulfate bonded hetero-dimer protein composed of two chains. Chain A of 21 amino acids and a thoretical amolecular mass of 2408.5; Chain B of 30 amino acids and a thoretical amolecular mass of 3468.7 (Note that Thr30 in chain B is not 15N labeled).

Biochem/physiol Actions

Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat.

Sequence

A chain: GIVEQCCTSICSLYQLENYCN
B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Physical form

Supplied as dried pellet from a solution containing 1% acetic acid.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

nwg

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Customers Also Viewed

Slide 1 of 1

1 of 1

Insulin human recombinant, expressed in yeast (proprietary host)

Sigma-Aldrich

I2643

Insulin human

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service